Structure of PDB 4v4j Chain V Binding Site BS02

Receptor Information
>4v4j Chain V (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL
Ligand information
>4v4j Chain 2 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggauuuagcucaguugggagagcgccagacugaaaaucuggagguccu
guguucgauccacagaauucgcacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
Resolution3.83 Å
Binding residue
(original residue number in PDB)		R26 E27
Binding residue
(residue number reindexed from 1)		R19 E20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
PDBsum4v4j
PubMed17940016
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]