Structure of PDB 3cxc Chain V Binding Site BS02

Receptor Information

>3cxc Chain V (length=154) Species: 2238 (Haloarcula marismortui)

MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVND
FVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFAL
LSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLL
EAMR

Ligand information

>3cxc Chain 9 (length=122)

uuaggcggccacagcggugggguugccucccguacccaucccgaacacgg
aagauaagcccaccagcguuccggggaguacuggagugcgcgagccucug
ggaaacccgguucgccgccacc

...<<<<<<....<<<<<<<<......<<<<<<.............>>>>
..>>....>>>>>>.>><..<<<<<.....<<<<<<.<<....>>>>>>>
>....>>>>>.>.>>>>>>...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3cxc Design at the atomic level: design of biaryloxazolidinones as potent orally active antibiotics.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): R8 H14 D50 K129 H130 K133 E134
• Binding residue (residue number reindexed from 1): R8 H14 D50 K129 H130 K133 E134
• Binding affinity: PDBbind-CN: IC50=4.6uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3cxc, PDBe:3cxc, PDBj:3cxc
• PDBsum: 3cxc
• PubMed: 18947996
• UniProt: P14121|RL30_HALMA Large ribosomal subunit protein uL30 (Gene Name=rpl30)