Structure of PDB 7ajt Chain UX Binding Site BS02

Receptor Information
>7ajt Chain UX (length=174) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRKFGLVKRTLNTKKDQRLKKNQENTRNIPQVSSALFFQYNQAIKPPYQV
LIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRI
ALKLARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIR
KIPGIPLMSVGGHAYVIEKLPDVF
Ligand information
>7ajt Chain D4 (length=230) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucauaggaucauuucuauaggaaucgucacucuuugacu
cuucaaaagagccacugaauccaacuugguugaugagucccauaaccuuu
guacccgugagaaauagcuugguccgcaauccuuagcgguucggccaucu
auaauuuugaauaaaaauuuugccguugcuauggcgcgaugaucuaccca
uggguggguacaaauggcagucugacaagu
..................................................
.......................<<<<<.................<<<<<
<<<<<.<.......<<...<<<.<<<.<<<<......>>>>>>>>>>..>
>.<<<<<......>>.>>>..<<<<......>>>>........>.<<<..
..>>>.>>>>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ajt Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
Resolution4.6 Å
Binding residue
(original residue number in PDB)
Q23 Y136
Binding residue
(residue number reindexed from 1)
Q17 Y121
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004521 RNA endonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ajt, PDBe:7ajt, PDBj:7ajt
PDBsum7ajt
PubMed33326748
UniProtQ05498|FCF1_YEAST rRNA-processing protein FCF1 (Gene Name=FCF1)

[Back to BioLiP]