Structure of PDB 6zqd Chain UX Binding Site BS02

Receptor Information

>6zqd Chain UX (length=167) Species: 559292 (Saccharomyces cerevisiae S288C)

AKKTRKFGLVKRTLNTKKTRNIPQVSSALFFQYNQAIKPPYQVLIDTNFI
NFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKLARD
PRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPL
MSVGGHAYVIEKLPDVF

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 6zqd Chain UX Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6zqd 90 S pre-ribosome transformation into the primordial 40 S subunit.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): C130 H132 C140
• Binding residue (residue number reindexed from 1): C108 H110 C118
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0004521 RNA endonuclease activity
• GO:0004540 RNA nuclease activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding

Biological Process

• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0032040 small-subunit processome

External links

• PDB: RCSB:6zqd, PDBe:6zqd, PDBj:6zqd
• PDBsum: 6zqd
• PubMed: 32943521
• UniProt: Q05498|FCF1_YEAST rRNA-processing protein FCF1 (Gene Name=FCF1)