Structure of PDB 6rxy Chain UX Binding Site BS02

Receptor Information
>6rxy Chain UX (length=190) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVAKRTRKFATVKRIIGKQDERRKAEAVKKAEEEKRKKEKQAIREVPQMP
SSMFFEHNEALVPPYNVLVDTNFLSRTVGAKLPLLESAMDCLYASVNIII
TSCVMAELEKLGPRYRVALMIARDERWQRLTCDHKGTYADDCIVDRVQKH
RIYIVATNDRDLKRRIRKIPGVPIMSVQKGKYAIERLPGA
Ligand information
>6rxy Chain C2 (length=230) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcgacaauacuucagagaaucauuucuauaguaguuguccucucuugug
uuuccuaaaggagccacagaucccacccggguugaugaacgagauccucg
gcgccagugagguccauuuacucucgcucuaccugcaaagguggcggucg
cgugccucgucucgcggcuguauagagaguggcgaugaucuguaccccgc
ggggugggugucgauggaagucugaccggc
..................................................
..........................<<<<..............<<<<<<
<<<<.<<............<<<<<<...<<<<<......>>>>><<<<<<
<<.<......>.>>>>>>>>....>>>>>>.........>>.<<<<<<..
>>>>>>.>>>>>>>.>>>.......>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rxy Thermophile 90S Pre-ribosome Structures Reveal the Reverse Order of Co-transcriptional 18S rRNA Subdomain Integration.
Resolution4.7 Å
Binding residue
(original residue number in PDB)		G-8 K-1 F0 R5 D11 E12 R27 K126 Y129
Binding residue
(residue number reindexed from 1)		G1 K8 F9 R14 D20 E21 R36 K135 Y138
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 12:49:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6rxy', asym_id = 'UX', bs = 'BS02', title = 'Thermophile 90S Pre-ribosome Structures Reveal t...o-transcriptional 18S rRNA Subdomain Integration.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6rxy', asym_id='UX', bs='BS02', title='Thermophile 90S Pre-ribosome Structures Reveal t...o-transcriptional 18S rRNA Subdomain Integration.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0032040', uniprot = '', pdbid = '6rxy', asym_id = 'UX'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0032040', uniprot='', pdbid='6rxy', asym_id='UX')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>