Structure of PDB 8rdw Chain UC Binding Site BS02

Receptor Information
>8rdw Chain UC (length=97) Species: 45610 (Psychrobacter urativorans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HFALNAVDRSAELQGKGASRRLRKQNLVPAIIYGGNEEPASISIKINELV
KALEFEAFFSHILTITVDGVEEQAVIKALQRHPAKGFPMHADFQRIV
Ligand information
>8rdw Chain D8 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcugacgaccauagcacgauggcaccaccugaucccuucccgaacucaga
agugaaacaucgucgcgccaaugguagugugguuucgaccaugugagagu
aggucaucgucagcu
<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>>.
.>>>...>>>>>>.>><<<.......<<<<<<<<..>>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rdw A new family of bacterial ribosome hibernation factors
Resolution2.74 Å
Binding residue
(original residue number in PDB)		R13 Q18 G19 K20 S23 R24 R25 R27 Y37 K81 Q84 H94 Q98
Binding residue
(residue number reindexed from 1)		R9 Q14 G15 K16 S19 R20 R21 R23 Y33 K77 Q80 H90 Q94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
PDBsum8rdw
PubMed38355796
UniProtA0A0M4U726

[Back to BioLiP]