Structure of PDB 7aju Chain UC Binding Site BS02

Receptor Information
>7aju Chain UC (length=86) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDRFKGDDDIDGKRAINYQILKNKGLTPKRNKDNRNSRVKKRKKYQKAQK
KLKSVRAVYSGGQSGVYEGEKTGIKKGLTRSVKFKN
Ligand information
>7aju Chain D4 (length=223) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgacguacuucaaggaucaucuauaggaaucgucacucuuugacucuu
cccacugaauccaacuugguugaugagucccauaaccuuuguaccccaga
gugagaaauagcuugguccgcaauccuuagcgguucggccaucuauaauu
uugaauaaaaauuuugccguugcuauggcgcgaugaucacccaugggugg
guacaaauggcagucugacaagu
..................................................
.............<<<<<.................<<<<<<<<<<<....
<........<<..<<<.<<<.<<<<......>>>>>>>>>>.>>..<<<<
<<....>>>.>>>..<<<<<....>>>>>........><<<<..>>>>>>
>>>>>>>.>>........>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7aju Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Q587 S588 G589
Binding residue
(residue number reindexed from 1)		Q63 S64 G65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aju, PDBe:7aju, PDBj:7aju
PDBsum7aju
PubMed33326748
UniProtQ12136|SAS10_YEAST Something about silencing protein 10 (Gene Name=SAS10)

[Back to BioLiP]