Structure of PDB 8ipa Chain UA Binding Site BS02

Receptor Information

>8ipa Chain UA (length=80) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TKGTGSFGKRRNKTHTLCIRCGRRSFHLQKSTCSSCGYPAARIRKYNWSV
KAIRRKTTGTGRMRYMRHVPRRFKSNFREG

Ligand information

>8ipa Chain SB (length=160) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacucucggcaacggauaucucggcucucgcaucgaugaagaacguagc
gaaaugcgauaccuggugugaauugcagaaucccgugaaccaucgagucu
uugaacgcaaguugcgcccgaggccauccggccgagggcacgccugccug
ggcgucacgc

.........................................<<<<<<.((
.....>>>....<<<<<<<.....))............>.>>>>.>>..>
>>....<<.....>><<<<..<<<<....>>>>..>>>>...........
..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ipa Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	T17 I20 R21 C22 G23 L29 T59 G62 R63 M64 R65 Y66 M67 R72 R73 F74 F78 R79 E80 G81
Binding residue (residue number reindexed from 1)	T16 I19 R20 C21 G22 L28 T58 G61 R62 M63 R64 Y65 M66 R71 R72 F73 F77 R78 E79 G80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ipa, PDBe:8ipa, PDBj:8ipa
PDBsum	8ipa
PubMed	38267667
UniProt	A0A1D6BC85

[Back to BioLiP]