Structure of PDB 7vvz Chain U Binding Site BS02

Receptor Information
>7vvz Chain U (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>7vvz Chain I (length=179) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcggatgtatatatctgacacgtgcctggagactagggagtaatcccct
tggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgcta
gagctgtctacgaccaattgagcggcctcggcaccgggattctcgatggc
ggccgcgtatagggtccccggaggacagt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vvz Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
Resolution8.8 Å
Binding residue
(original residue number in PDB)		Y42 S55 S56 R86 S87 T88
Binding residue
(residue number reindexed from 1)		Y10 S23 S24 R54 S55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7vvz, PDBe:7vvz, PDBj:7vvz
PDBsum7vvz
PubMed36198799
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]