Structure of PDB 7ml1 Chain U Binding Site BS02

Receptor Information

>7ml1 Chain U (length=44) Species: 4932 (Saccharomyces cerevisiae)

LMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV

Ligand information

>7ml1 Chain T (length=57)

tgtatgtacaaccgaattcgcgacattgaaacttttatatacgcgccttt
ttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ml1 Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
• Resolution: 4.0 Å
• Binding residue (original residue number in PDB): K250 K255
• Binding residue (residue number reindexed from 1): K8 K13

Gene Ontology

Molecular Function

• GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
• GO:0003712 transcription coregulator activity
• GO:0005515 protein binding
• GO:0017025 TBP-class protein binding

Biological Process

• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0005672 transcription factor TFIIA complex
• GO:0005737 cytoplasm

External links

• PDB: RCSB:7ml1, PDBe:7ml1, PDBj:7ml1
• PDBsum: 7ml1
• PubMed: 35051353
• UniProt: P32773|TOA1_YEAST Transcription initiation factor IIA large subunit (Gene Name=TOA1)