Structure of PDB 7k60 Chain U Binding Site BS02

Receptor Information
>7k60 Chain U (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSI
KALVQNDTLLQVKGTGANGSFKLNRK
Ligand information
>7k60 Chain J (length=197) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggggtggtcgctgttcaatacatgcacaggatgtatatatctgacacgtg
cctggagactagggagtaatccccttggcggttaaaacgcgggggacagc
gcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcgg
cctcggcaccgggattctccagggcggccgcgtatagggtccagccc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k60 Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
Resolution3.12 Å
Binding residue
(original residue number in PDB)
Q43 Q82 N83 R85 K89 Y90 K93 N110
Binding residue
(residue number reindexed from 1)
Q1 Q40 N41 R43 K47 Y48 K51 N68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0045296 cadherin binding
Biological Process
GO:0006334 nucleosome assembly
GO:0030261 chromosome condensation
GO:0045910 negative regulation of DNA recombination
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7k60, PDBe:7k60, PDBj:7k60
PDBsum7k60
PubMed33238161
UniProtQ92522|H1X_HUMAN Histone H1.10 (Gene Name=H1-10)

[Back to BioLiP]