Structure of PDB 6az3 Chain U Binding Site BS02

Receptor Information

>6az3 Chain U (length=121) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VAVRAKVGSRSYVRQKQLAKGKKVFKIDCSIPAADGIFSEDVLGNFEQFF
QDNTKLNGRKGKLSDKVRLSMNDNVLTISTTMAYRKKYFKYLTKKFLKKK
DLRDWIRILATGKGTYQLKYF

Ligand information

>6az3 Chain 3 (length=177) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agugguaaugcgaaacacugccagguaacaaaucaauccucccacgguga
gcuuucuuuucaccauaauccaccuugggccuuuuaccgcguuguucgga
gcgggggcucaagauugaaaaaugcagcucuacguacuguugugaguucu
gcgcauuaacgcaaaaaccuggggugu

.<<......>>.....<<<.<<<<<<.......<<...<<<<...<<<<<
<.......>>>>>><...<<.<.<<<<<<<<<<<...<<.......>>..
..>>>>>>>>>>>.>.>>....><<<<..<...>..>>>>.>.>>>...>
>...............>>>>>>>>>..

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6az3 Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	Q16 K56 N58 G59 K61 Y85 R86 K87 K88 Y89 K91 Y92 K96 K99 R104 R108 L110 A111 K120
Binding residue (residue number reindexed from 1)	Q15 K55 N57 G58 K60 Y84 R85 K86 K87 Y88 K90 Y91 K95 K98 R103 R107 L109 A110 K119

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6az3, PDBe:6az3, PDBj:6az3
PDBsum	6az3
PubMed	29150609
UniProt	A0A3Q8IJA8

[Back to BioLiP]