Structure of PDB 5nrl Chain U Binding Site BS02

Receptor Information
>5nrl Chain U (length=196) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKGENVPYTFQDEQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLG
GKKHGLNVLRRGISIEKSSDFRQQQKIIEAKQSLKNNGTIPGSVGLAIQV
NYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFE
NIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nrl Structure of a pre-catalytic spliceosome.
Resolution7.2 Å
Binding residue
(original residue number in PDB)		C71 M76 S77
Binding residue
(residue number reindexed from 1)		C35 M40 S41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
PDBsum5nrl
PubMed28530653
UniProtQ07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)

[Back to BioLiP]