Structure of PDB 3j47 Chain U Binding Site BS02

Receptor Information
>3j47 Chain U (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRLTNQLKSLKGLQSKLKDVVEYLDKVIHTILGKLQDVFNLNNLQKALTV
KTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKD
Ligand information
>3j47 Chain Q (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ATYDSALELVGQLNKVVDQLFEKAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j47 Formation of an Intricate Helical Bundle Dictates the Assembly of the 26S Proteasome Lid.
Resolution7.4 Å
Binding residue
(original residue number in PDB)		V282 I285 I286 D289 I292 E293 I296 Q297 K300
Binding residue
(residue number reindexed from 1)		V65 I68 I69 D72 I75 E76 I79 Q80 K83
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3j47, PDBe:3j47, PDBj:3j47
PDBsum3j47
PubMed23911091
UniProtQ08723|RPN8_YEAST 26S proteasome regulatory subunit RPN8 (Gene Name=RPN8)

[Back to BioLiP]