Structure of PDB 1pp8 Chain U Binding Site BS02

Receptor Information
>1pp8 Chain U (length=111) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSNDLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQL
EEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGG
WTQWKRSGFTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pp8 Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
Resolution3.05 Å
Binding residue
(original residue number in PDB)		R24 K25 S27 K69 R88 Q94 H97 D98
Binding residue
(residue number reindexed from 1)		R23 K24 S26 K68 R87 Q93 H96 D97
Binding affinityPDBbind-CN: Kd=190nM
Enzymatic activity
Enzyme Commision number ?
External links