Structure of PDB 8wlq Chain T Binding Site BS02

Receptor Information
>8wlq Chain T (length=110) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRGRAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQ
LKGMMNVLQG
Ligand information
>8wlq Chain j (length=20) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wlq Cryo-EM structure of the whole rod-export apparatus with hook within the flagellar motor-hook complex in the CCW state.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Q39 L86 Y87 V89 P90
Binding residue
(residue number reindexed from 1)		Q37 L60 Y61 V63 P64
External links
PDB RCSB:8wlq, PDBe:8wlq, PDBj:8wlq
PDBsum8wlq
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]