Structure of PDB 8wkq Chain T Binding Site BS02

Receptor Information
>8wkq Chain T (length=127) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRGRGVALTLTSSHHIPAQAVAVDLLYRVPDQPSLDGNTVDMDRERTQF
ADNSLKYQMGLTVLGSQLKGMMNVLQG
Ligand information
>8wkq Chain j (length=20) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wkq Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Q39 L86 Y87 R88 V89 P90 S94 L95 G97
Binding residue
(residue number reindexed from 1)		Q37 L77 Y78 R79 V80 P81 S85 L86 G88
External links
PDB RCSB:8wkq, PDBe:8wkq, PDBj:8wkq
PDBsum8wkq
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]