Structure of PDB 8wkk Chain T Binding Site BS02

Receptor Information
>8wkk Chain T (length=110) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVRGRAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQ
LKGMMNVLQG
Ligand information
>8wkk Chain j (length=20) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wkk Cryo-EM structure of the whole rod with export apparatus and hook within the flagellar motor-hook complex in the CW state.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		Q39 L86 Y87 R88 V89 P90 S94 L95 G97
Binding residue
(residue number reindexed from 1)		Q37 L60 Y61 R62 V63 P64 S68 L69 G71
External links
PDB RCSB:8wkk, PDBe:8wkk, PDBj:8wkk
PDBsum8wkk
PubMed
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]