Structure of PDB 8ipx Chain T Binding Site BS02

Receptor Information
>8ipx Chain T (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIV
VNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEVQLK
RQPAPPREAHFVRTNGKEPELLEP
Ligand information
>8ipx Chain 3 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggaccgccuggaaua
ccgggugcuguaggc
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<.......<.<<.<<<..>>>>>.>.....
>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Resolution4.3 Å
Binding residue
(original residue number in PDB)
P26 L27 A28
Binding residue
(residue number reindexed from 1)
P1 L2 A3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtP46778|RL21_HUMAN Large ribosomal subunit protein eL21 (Gene Name=RPL21)

[Back to BioLiP]