Structure of PDB 6ylg Chain T Binding Site BS02

Receptor Information
>6ylg Chain T (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVI
INKMVGNRYLEKRLNLRVEHIKHSKCRQEFLERVKANAAKRAEAKAVQLK
RQPAQPRESRIVSTEGNVPQTLAP
Ligand information
>6ylg Chain 3 (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggcauacgcgaaa
cucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<....<<<.<<<............>>>...
.>>...>>>>>>>.>><<<<<<.......<<<<<.......>>>>>....
.>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ylg Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		H26 L27 S28
Binding residue
(residue number reindexed from 1)		H1 L2 S3
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ylg, PDBe:6ylg, PDBj:6ylg
PDBsum6ylg
PubMed32668200
UniProtQ02753|RL21A_YEAST Large ribosomal subunit protein eL21A (Gene Name=RPL21A)

[Back to BioLiP]