Structure of PDB 6p02 Chain T Binding Site BS02

Receptor Information
>6p02 Chain T (length=91) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
cVTIDADLMDAADLLEGEQVTIVDIDNGARLVTYAITGERGSGVIGINGA
AAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNKPI
Ligand information
>6p02 Chain S (length=24) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRTMLKSKIHRATVTCADLHYVG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p02 The molecular basis of pyrazinamide activity on Mycobacterium tuberculosis PanD.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		A36 E42 I69 G70 I71 N72 G73 A76 P81 D83 L84 V85 I86 L87 I88 A89 Y90 A91 T92 M93 D95 A98 P103 R104 I105 V106 V108 N112
Binding residue
(residue number reindexed from 1)		A12 E18 I45 G46 I47 N48 G49 A52 P57 D59 L60 V61 I62 L63 I64 A65 Y66 A67 T68 M69 D71 A74 P79 R80 I81 V82 V84 N88
Enzymatic activity
Enzyme Commision number 4.1.1.11: aspartate 1-decarboxylase.
Gene Ontology
Molecular Function
GO:0004068 aspartate 1-decarboxylase activity
Biological Process
GO:0006523 alanine biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6p02, PDBe:6p02, PDBj:6p02
PDBsum6p02
PubMed31953389
UniProtP9WIL3|PAND_MYCTU Aspartate 1-decarboxylase (Gene Name=panD)

[Back to BioLiP]