Structure of PDB 6j6n Chain T Binding Site BS02

Receptor Information
>6j6n Chain T (length=157) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLW
EIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGY
EKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGC
RGCASTD
Ligand information
>6j6n Chain E (length=103) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua
<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6j6n Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
Resolution3.86 Å
Binding residue
(original residue number in PDB)		K40 A42 T98 E101 T114 N115 N116 S118 T119 C120 I121 R123 V124 Q128 E132 V146 H147 S155 T156
Binding residue
(residue number reindexed from 1)		K40 A42 T98 E101 T114 N115 N116 S118 T119 C120 I121 R123 V124 Q128 E132 V146 H147 S155 T156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000282 cellular bud site selection
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6j6n, PDBe:6j6n, PDBj:6j6n
PDBsum6j6n
PubMed30879786
UniProtP25337|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)

[Back to BioLiP]