Structure of PDB 6f2r Chain T Binding Site BS02

Receptor Information
>6f2r Chain T (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKIILRHLIGKSHFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDE
HGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILVVEVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6f2r Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
L133 C134
Binding residue
(residue number reindexed from 1)
L77 C78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006986 response to unfolded protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0016607 nuclear speck

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6f2r, PDBe:6f2r, PDBj:6f2r
PDBsum6f2r
PubMed29969581
UniProtQ12988|HSPB3_HUMAN Heat shock protein beta-3 (Gene Name=HSPB3)

[Back to BioLiP]