Structure of PDB 5iy9 Chain T Binding Site BS02

Receptor Information
>5iy9 Chain T (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGR
TEVSFTLNEDLANEHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAEC
RPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYE
RKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEI
LKEIGVQNVKGIHKNTWELKPE
Ligand information
>5iy9 Chain Y (length=83) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tccgtaggcacgtctgctcggctcgagtgttcgatcgcgactgaggacga
acgcgcccccacccccttctataggcgcccttc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iy9 Near-atomic resolution visualization of human transcription promoter opening.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		K169 K214 H229
Binding residue
(residue number reindexed from 1)		K153 K198 H213
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005674 transcription factor TFIIF complex
GO:0015630 microtubule cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iy9, PDBe:5iy9, PDBj:5iy9
PDBsum5iy9
PubMed27193682
UniProtP13984|T2FB_HUMAN General transcription factor IIF subunit 2 (Gene Name=GTF2F2)

[Back to BioLiP]