Structure of PDB 5gm6 Chain T Binding Site BS02

Receptor Information

>5gm6 Chain T (length=157) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLW
EIMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGY
EKLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGC
RGCASTD

Ligand information

>5gm6 Chain E (length=103) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua

<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution
Resolution	3.5 Å
Binding residue (original residue number in PDB)	L41 A42 T98 E101 T114 N115 S118 T119 C120 I121 V124 Q128 E132 V146 H147 S155
Binding residue (residue number reindexed from 1)	L41 A42 T98 E101 T114 N115 S118 T119 C120 I121 V124 Q128 E132 V146 H147 S155

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0000282	cellular bud site selection
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing

	Cellular Component
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005686	U2 snRNP

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum	5gm6
PubMed	27445306
UniProt	P25337\|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)

[Back to BioLiP]