Structure of PDB 4d0m Chain T Binding Site BS02

Receptor Information
>4d0m Chain T (length=173) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQV
DGKTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERW
LKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSA
LDSTNVEAAFQTILTEIYRIVSQ
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain4d0m Chain T Residue 2001 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4d0m Structures of Pi4Kiiibeta Complexes Show Simultaneous Recruitment of Rab11 and its Effectors.
Resolution6.0 Å
Binding residue
(original residue number in PDB)		S25 T43
Binding residue
(residue number reindexed from 1)		S20 T38
Annotation score1
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008017 microtubule binding
GO:0016787 hydrolase activity
GO:0019905 syntaxin binding
GO:0031489 myosin V binding
GO:0051959 dynein light intermediate chain binding
Biological Process
GO:0006887 exocytosis
GO:0007080 mitotic metaphase chromosome alignment
GO:0010634 positive regulation of epithelial cell migration
GO:0010796 regulation of multivesicular body size
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0030953 astral microtubule organization
GO:0031175 neuron projection development
GO:0032402 melanosome transport
GO:0032465 regulation of cytokinesis
GO:0034394 protein localization to cell surface
GO:0036258 multivesicular body assembly
GO:0043001 Golgi to plasma membrane protein transport
GO:0048227 plasma membrane to endosome transport
GO:0051650 establishment of vesicle localization
GO:0060627 regulation of vesicle-mediated transport
GO:0061502 early endosome to recycling endosome transport
GO:0061512 protein localization to cilium
GO:0071806 protein transmembrane transport
GO:0072594 establishment of protein localization to organelle
GO:0072659 protein localization to plasma membrane
GO:0090150 establishment of protein localization to membrane
GO:0090307 mitotic spindle assembly
GO:0098887 neurotransmitter receptor transport, endosome to postsynaptic membrane
GO:0150093 amyloid-beta clearance by transcytosis
GO:1902017 regulation of cilium assembly
GO:1902954 regulation of early endosome to recycling endosome transport
GO:1903438 positive regulation of mitotic cytokinetic process
GO:1904779 regulation of protein localization to centrosome
GO:1990182 exosomal secretion
GO:2001135 regulation of endocytic recycling
Cellular Component
GO:0000139 Golgi membrane
GO:0000922 spindle pole
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005771 multivesicular body
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005813 centrosome
GO:0005814 centriole
GO:0005828 kinetochore microtubule
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030133 transport vesicle
GO:0030659 cytoplasmic vesicle membrane
GO:0030666 endocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0031982 vesicle
GO:0032154 cleavage furrow
GO:0032588 trans-Golgi network membrane
GO:0032991 protein-containing complex
GO:0034451 centriolar satellite
GO:0043231 intracellular membrane-bounded organelle
GO:0045335 phagocytic vesicle
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0098837 postsynaptic recycling endosome
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d0m, PDBe:4d0m, PDBj:4d0m
PDBsum4d0m
PubMed24876499
UniProtP62491|RB11A_HUMAN Ras-related protein Rab-11A (Gene Name=RAB11A)

[Back to BioLiP]