Structure of PDB 8bsj Chain Sj Binding Site BS02

Receptor Information
>8bsj Chain Sj (length=67) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RAHGGLTSAGKVRKCTPKKEKKEKPRPPRGRAYKRLLYNKNFVDDTLIHN
GRRLGPNNLLIRQKLGF
Ligand information
>8bsj Chain x (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcggauuuacucagaagggagagcaccagaauaucaaaauggaguccugu
guucgauccacagaauucgcacca
<<<<<<<..<<<........>>>..<<<...........>>>....<<<<
<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution6.49 Å
Binding residue
(original residue number in PDB)		R1 A2
Binding residue
(residue number reindexed from 1)		R1 A2
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum8bsj
PubMed36912103
UniProtA0A644F843

[Back to BioLiP]