Structure of PDB 3j7r Chain Sa Binding Site BS02

Receptor Information

>3j7r Chain Sa (length=98) Species: 9823 (Sus scrofa)

TKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVR
DISEASVFDAYVLPKLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPP

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 3j7r Chain Sa Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3j7r Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
• Resolution: 3.9 Å
• Binding residue (original residue number in PDB): C23 C26 C74 C77
• Binding residue (residue number reindexed from 1): C22 C25 C73 C76
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022626 cytosolic ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j7r, PDBe:3j7r, PDBj:3j7r
• PDBsum: 3j7r
• PubMed: 24930395
• UniProt: P49171|RS26_PIG Small ribosomal subunit protein eS26 (Gene Name=RPS26)