Structure of PDB 6t4q Chain SZ Binding Site BS02

Receptor Information
>6t4q Chain SZ (length=82) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYVSVSVLVDRLKIGG
SLARIALRHLEKEGIIKPISKHSKQAIYTRAT
Ligand information
>6t4q Chain 6 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuccucguggcccaauggucacggcgucuggcuacgaaccagaagauucc
agguucaaguccuggcggggaagcca
<<<<<<<..<<<..........>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t4q Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		K25 W27
Binding residue
(residue number reindexed from 1)		K2 W4
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6t4q, PDBe:6t4q, PDBj:6t4q
PDBsum6t4q
PubMed31858614
UniProtQ3E792|RS25A_YEAST Small ribosomal subunit protein eS25A (Gene Name=RPS25A)

[Back to BioLiP]