Structure of PDB 5it7 Chain SS Binding Site BS02

Receptor Information
>5it7 Chain SS (length=169) Species: 28985 (Kluyveromyces lactis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FKEYQVIGRRLPTESVPEPKLFRMRIFAPNDVVAKSRYWYFLQKLHKVKK
ASGEIVSLNVISEAHPTTVKNFGVWVRYDSRSGTHNMYKEIRDVTRVGAV
ESLYQDMAARHRARFRSIHILKVVELEKTADVKRQYVKQFLTKDLKFPLP
HRVQKSTKVFAYKRPTTFY
Ligand information
>5it7 Chain 7 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5it7 Structural characterization of ribosome recruitment and translocation by type IV IRES.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		R13 S39 R40 Y43 Q46 H49 K50 K52 A54 R84 R119
Binding residue
(residue number reindexed from 1)		R10 S36 R37 Y40 Q43 H46 K47 K49 A51 R81 R116
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 22:59:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '5it7', asym_id = 'SS', bs = 'BS02', title = 'Structural characterization of ribosome recruitment and translocation by type IV IRES.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='5it7', asym_id='SS', bs='BS02', title='Structural characterization of ribosome recruitment and translocation by type IV IRES.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '5it7', asym_id = 'SS'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='5it7', asym_id='SS')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>