Structure of PDB 6om0 Chain SP Binding Site BS02

Receptor Information
>6om0 Chain SP (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKR
LRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKP
EMIGHYLGEFSITYKPVKHGRPGIGAT
Ligand information
>6om0 Chain v (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcccgguagccccgaagguagagcaggggauuccgaauccccguguccu
ugguucgauuccgaguccgggcacca
.<<<<<<..<<............>>.<<<<<<.....>>>>>>......<
<<.........>.>>.>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6om0 Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		A135 T136
Binding residue
(residue number reindexed from 1)		A126 T127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6om0, PDBe:6om0, PDBj:6om0
PDBsum6om0
PubMed31160784
UniProtP62841|RS15_HUMAN Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]