Structure of PDB 8bsj Chain SO Binding Site BS02

Receptor Information
>8bsj Chain SO (length=140) Species: 5741 (Giardia intestinalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKTSGLYTARKLRTVRRVNRWADKKYRKAHLGTWLKANPLEGACMARGI
VTQKIGISAKQPNSAVRKAVRVQLTKNSKKITAFVPRDGSITYIDNNDEV
LVAGFGRAGRAVGDIPGCRFKVIKVAGIGLLALFLRKREK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.
Resolution6.49 Å
Binding residue
(original residue number in PDB)		Q61 P62
Binding residue
(residue number reindexed from 1)		Q61 P62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum8bsj
PubMed36912103
UniProtV6T9I6

[Back to BioLiP]