Structure of PDB 8rxh Chain SK Binding Site BS02

Receptor Information
>8rxh Chain SK (length=192) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIVRSRLHKRKITGGKTKIHRKRMKAELGRLPANTRLGARRVSPVRARGG
NFKIRALRLDTGNFAWASEAIAHRVRLLDVVYNATSNELVRTKTLVKNCI
VAVDAAPFKRWYAKHYGIDLDADKYDVNKASPKLQREWTRRRRNHRVEKA
IADQLREGRVLARITSRPGQSGRADGILLEGAELQFYLKRLE
Ligand information
>8rxh Chain L5 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacgucccucuccaaacgagagaacaugcaugggcuggcaugagcggca
ugcuucuccgguggggcuccgucccgaggcgcugaaccuugaggccugaa
aauucaugcucagggacacu
....<<<<<<<<<.......>>>>....<<<<<<<<.<<.....<<<...
..............<<.......>>....>>>....>>.....>>>....
....>>>>>...>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		L79 R92
Binding residue
(residue number reindexed from 1)		L78 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum8rxh
PubMed38722744
UniProtP25204|RS8_LEIMA Small ribosomal subunit protein eS8 (Gene Name=RPS8A)

[Back to BioLiP]