Structure of PDB 8fl2 Chain SI Binding Site BS02

Receptor Information
>8fl2 Chain SI (length=234) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLVPENLLKKRKAYQALKATQAKQALLAKKEQKKGRFKRLESFLHDSWRQ
KRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRL
KKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKN
KTIPLTDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLS
VARHATKNRVGFLKEMGTPGYRGERINQLIRQLN
Ligand information
>8fl2 Chain L2 (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccucc
gucccccuaagcgcagacgaga
.........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.>
>.>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fl2 Principles of human pre-60 S biogenesis.
Resolution2.67 Å
Binding residue
(original residue number in PDB)
K51 L65 H66 W69 R73 V76 R79 R80 K84 P85 H86 R224 T227 K228 R230
Binding residue
(residue number reindexed from 1)
K33 L44 H45 W48 R52 V55 R58 R59 K63 P64 H65 R203 T206 K207 R209
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001825 blastocyst formation
Cellular Component
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fl2, PDBe:8fl2, PDBj:8fl2
PDBsum8fl2
PubMed37410842
UniProtQ6DKI1|RL7L_HUMAN Ribosomal protein uL30-like (Gene Name=RPL7L1)

[Back to BioLiP]