Structure of PDB 8fkw Chain SI Binding Site BS02

Receptor Information
>8fkw Chain SI (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENLLKKRKAYQALKATQAKQALLARFKRLESFLHDSWRQKRDKVRLRRLE
VKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVKV
TPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNTVI
EEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARHATKNRVG
FLKEMGTPGYRGERINQLIRQLN
Ligand information
>8fkw Chain L2 (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccuc
cgucccccuaagcgcagac
..........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.
>>.>>>>>...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fkw Principles of human pre-60 S biogenesis.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		L65 H66 W69 R70 K72 R73 V76 R80 K84 P85 H86 R104 D106 R230
Binding residue
(residue number reindexed from 1)		L33 H34 W37 R38 K40 R41 V44 R48 K52 P53 H54 R72 D74 R198
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001825 blastocyst formation
Cellular Component
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkw, PDBe:8fkw, PDBj:8fkw
PDBsum8fkw
PubMed37410842
UniProtQ6DKI1|RL7L_HUMAN Ribosomal protein uL30-like (Gene Name=RPL7L1)

[Back to BioLiP]