Structure of PDB 8fkv Chain SI Binding Site BS02

Receptor Information

>8fkv Chain SI (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VPENLLKKRKAYQALKATQAKQALLARFKRLESFLHDSWRQKRDKVRLRR
LEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFV
KVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNT
VIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARHATKNR
VGFLKEMGTPGYRGERINQLIRQLN

Ligand information

>8fkv Chain L2 (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccuc
cgucccccuaagcgcagac

..........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.
>>.>>>>>...........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8fkv Principles of human pre-60 S biogenesis.
Resolution	2.47 Å
Binding residue (original residue number in PDB)	H66 W69 K72 R73 V76 R80 K84 P85 H86 R104 D106 R230
Binding residue (residue number reindexed from 1)	H36 W39 K42 R43 V46 R50 K54 P55 H56 R74 D76 R200

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001825	blastocyst formation

	Cellular Component
GO:0005730	nucleolus
GO:0005739	mitochondrion
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fkv, PDBe:8fkv, PDBj:8fkv
PDBsum	8fkv
PubMed	37410842
UniProt	Q6DKI1\|RL7L_HUMAN Ribosomal protein uL30-like (Gene Name=RPL7L1)

[Back to BioLiP]