Structure of PDB 8fkq Chain SH Binding Site BS02

Receptor Information
>8fkq Chain SH (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFV
EFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQP
SYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQ
Ligand information
>8fkq Chain LH (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KAEAKAKALKAKKAVLKGVH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fkq Principles of human pre-60 S biogenesis.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		Q67 F68 D97 V98 T105
Binding residue
(residue number reindexed from 1)		Q26 F27 D56 V57 T64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0009303 rRNA transcription
GO:0016072 rRNA metabolic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkq, PDBe:8fkq, PDBj:8fkq
PDBsum8fkq
PubMed37410842
UniProtQ9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)

[Back to BioLiP]