Structure of PDB 8k2c Chain SF Binding Site BS02

Receptor Information
>8k2c Chain SF (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQ
CPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNA
IINSGPREDSTRIGRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIA
ECLADELINAAKGSSNSYAIKKKDELERVAKSNR
Ligand information
>8k2c Chain CC (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcagaguggcgcagcggaagcgugcugggcccauaacccagaggucgau
ggaucgaaaccauccucugcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8k2c Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		I128 G129 R135 K192 R198
Binding residue
(residue number reindexed from 1)		I113 G114 R115 K172 R178
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:0006450 regulation of translational fidelity
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k2c, PDBe:8k2c, PDBj:8k2c
PDBsum8k2c
PubMed38942792
UniProtP46782|RS5_HUMAN Small ribosomal subunit protein uS7 (Gene Name=RPS5)

[Back to BioLiP]