Structure of PDB 8fkv Chain SE Binding Site BS02

Receptor Information
>8fkv Chain SE (length=185) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPE
TKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLV
VIAHDVDPIELVVFLPALCRKMGVPYCIIKGKARLGRLVHRKTCTTVAFT
QVNSEDKGALAKLVEAIRTNYNDRYDEIRRHWGGN
Ligand information
>8fkv Chain L2 (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccuc
cgucccccuaagcgcagac
..........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.
>>.>>>>>...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fkv Principles of human pre-60 S biogenesis.
Resolution2.47 Å
Binding residue
(original residue number in PDB)		K97 K217
Binding residue
(residue number reindexed from 1)		K42 K162
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045296 cadherin binding
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0045202 synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fkv, PDBe:8fkv, PDBj:8fkv
PDBsum8fkv
PubMed37410842
UniProtP62424|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)

[Back to BioLiP]