Structure of PDB 6zm7 Chain SC Binding Site BS02

Receptor Information
>6zm7 Chain SC (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLK
IMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILA
KLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAP
VPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKE
TVFTKSPYQEFTDHLVKTHTRV
Ligand information
>6zm7 Chain CF (length=29) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPYEDFQENWNTKHSSGVTRELMRELNGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zm7 Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		E105 K108 I109 P111 Q113 T122 F124 V147 I151
Binding residue
(residue number reindexed from 1)		E47 K50 I51 P53 Q55 T64 F66 V89 I93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0017134 fibroblast growth factor binding
GO:0019899 enzyme binding
GO:0045296 cadherin binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0051443 positive regulation of ubiquitin-protein transferase activity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0015935 small ribosomal subunit
GO:0016020 membrane
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zm7, PDBe:6zm7, PDBj:6zm7
PDBsum6zm7
PubMed32680882
UniProtP15880|RS2_HUMAN Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]