Structure of PDB 8rbx Chain S Binding Site BS02

Receptor Information
>8rbx Chain S (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQ
EASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8rbx Chain T (length=161) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatcgatatcgg
ccaccacccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rbx Structural basis of Integrator-dependent RNA polymerase II termination
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R49 E50 R52 R53 K56 L61 I62 R63 K64 L65 P66
Binding residue
(residue number reindexed from 1)		R6 E7 R9 R10 K13 L18 I19 R20 K21 L22 P23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0030307 positive regulation of cell growth
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rbx, PDBe:8rbx, PDBj:8rbx
PDBsum8rbx
PubMed38570683
UniProtQ6NXT2|H3C_HUMAN Histone H3.3C (Gene Name=H3-5)

[Back to BioLiP]