Structure of PDB 8kd2 Chain S Binding Site BS02

Receptor Information
>8kd2 Chain S (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8kd2 Chain Y (length=174) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaccctatacgcggccgccctggagaatcccggtgccgaggccgctcaat
tggtcgtagacagctctagcaccgcttaaacgcacgtacgcgctgtcccc
cgcgttttaaccgccaaggggattactccctagtctccaggcacgtgtca
gatatatacatcctgttctagagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8kd2 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
Resolution3.02 Å
Binding residue
(original residue number in PDB)		R72 F84 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		R35 F47 R79 V80 T81 M83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kd2, PDBe:8kd2, PDBj:8kd2
PDBsum8kd2
PubMed37666978
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]