Structure of PDB 8etc Chain S Binding Site BS02

Receptor Information
>8etc Chain S (length=168) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALKEYQVVGRKVPTEHEPVPKLFRMRLFAPNESVAKSRYWYFLKMINKVK
KATGEIVAINEISEPKPLKAKVFGIWIRYDSRSGTHNMYKEFRDTTRVGA
VEAMYADMAARHRARFRSIRILKVVEVEKKEDVRRNYVKQLLNPHLKFPL
PHRRTKKVFAPHRPSTFY
Ligand information
>8etc Chain T (length=21) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APPAKAHFVSTENNEPVTLHP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8etc Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		V9 R11 P21 L23 F24 R25 M26 I47 V58 L123
Binding residue
(residue number reindexed from 1)		V8 R10 P20 L22 F23 R24 M25 I46 V57 L122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etc, PDBe:8etc, PDBj:8etc
PDBsum8etc
PubMed36423630
UniProtP0CT68|RL20A_SCHPO Large ribosomal subunit protein eL20A (Gene Name=rpl2001)

[Back to BioLiP]