Structure of PDB 7ope Chain S Binding Site BS02

Receptor Information
>7ope Chain S (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF
Ligand information
>7ope Chain B (length=112) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa
<<<<<<<....<<<<<<<<.....<<<<<...............>>>..>
>....>>>>>>.>>.<<.....<.<<.<<<<<...>>>>>.>>...>...
>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ope RqcH and RqcP catalyze processive poly-alanine synthesis in a reconstituted ribosome-associated quality control system.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
K7 R11 H15 R19 R30 N32 F34 R35 S36 N37 K38 H39 Y41 T52 L59 Y100 L101 H103 G104 R105
Binding residue
(residue number reindexed from 1)
K7 R11 H15 R19 R30 N32 F34 R35 S36 N37 K38 H39 Y41 T52 L59 Y100 L101 H103 G104 R105
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ope, PDBe:7ope, PDBj:7ope
PDBsum7ope
PubMed34255840
UniProtP46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]