Structure of PDB 7of1 Chain S Binding Site BS02

Receptor Information
>7of1 Chain S (length=170) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTF
Ligand information
>7of1 Chain 3 (length=43) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cugaccgaguaguguagugggugaccauacgcgaaacucaggu
<<<<.......<<<<<..<<....>>.>>>>>.....>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7of1 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		V19 R40 Y43 Q46 H49 K50 V51 K52 R119
Binding residue
(residue number reindexed from 1)		V18 R39 Y42 Q45 H48 K49 V50 K51 R118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7of1, PDBe:7of1, PDBj:7of1
PDBsum7of1
PubMed34813592
UniProtP0CX23|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]