Structure of PDB 6yhs Chain S Binding Site BS02

Receptor Information
>6yhs Chain S (length=76) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKNGRDSNPKMLGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHT
LFATADGVVKFEVKGQFGRRYVKVET
Ligand information
>6yhs Chain 5 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yhs Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		G73 Q74
Binding residue
(residue number reindexed from 1)		G65 Q66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yhs, PDBe:6yhs, PDBj:6yhs
PDBsum6yhs
PubMed32857965
UniProtD0CDQ7

[Back to BioLiP]