Structure of PDB 6cnc Chain S Binding Site BS02

Receptor Information
>6cnc Chain S (length=217) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAAAAAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAATAIQLKL
NPDGTMAIDEETMVVDRHKNASIENEYKEKVDENPFANLYNYGSYGRGSY
TDPWTVEEMIKFYKALSMWGTDFNLISQLYPYRSRKQVKAKFVNEEKKRP
ILIELALRSKLPPNFDEYCCEIKKNIGTVADFNEKLIELQNEHKHHMKEI
EEAKNTAKEEDQTAQRL
Ligand information
>6cnc Chain Y (length=61) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccatggagtcattttatcttgtgtcacttacagaaaaagtattactaata
tatgttgaaaa
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6cnc Structural visualization of RNA polymerase III transcription machineries.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		X311 N407 Y408 G409 Y416 K455
Binding residue
(residue number reindexed from 1)		X35 N91 Y92 G93 Y100 K139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001156 TFIIIC-class transcription factor complex binding
Biological Process
GO:0001112 DNA-templated transcription open complex formation
GO:0006355 regulation of DNA-templated transcription
GO:0006359 regulation of transcription by RNA polymerase III
GO:0006383 transcription by RNA polymerase III
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0000126 transcription factor TFIIIB complex
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6cnc, PDBe:6cnc, PDBj:6cnc
PDBsum6cnc
PubMed30083386
UniProtP46678|TFC5_YEAST Transcription factor TFIIIB component B'' (Gene Name=BDP1)

[Back to BioLiP]