Structure of PDB 5o5j Chain S Binding Site BS02

Receptor Information
>5o5j Chain S (length=82) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAV
HDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGH
Ligand information
>5o5j Chain g (length=11) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GRVARFEKRYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5o5j The Complete Structure of the Mycobacterium smegmatis 70S Ribosome.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		P9 P42 E64 V67 H69
Binding residue
(residue number reindexed from 1)		P8 P41 E63 V66 H68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o5j, PDBe:5o5j, PDBj:5o5j
PDBsum5o5j
PubMed28683309
UniProtA0QSD5|RS19_MYCS2 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]