Structure of PDB 5cdq Chain S Binding Site BS02

Receptor Information
>5cdq Chain S (length=193) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPGKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILN
VEKARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDG
AHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMN
PEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5cdq Structural basis of DNA gyrase inhibition by antibacterial QPT-1, anticancer drug etoposide and moxifloxacin.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		P415 E435 D437 G459 K460 D512
Binding residue
(residue number reindexed from 1)		P2 E22 D24 G46 K47 D99
Enzymatic activity
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524 ATP binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5cdq, PDBe:5cdq, PDBj:5cdq
PDBsum5cdq
PubMed26640131
UniProtP66937|GYRB_STAAN DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]