Structure of PDB 4wf9 Chain S Binding Site BS02

Receptor Information

>4wf9 Chain S (length=167) Species: 367830 (Staphylococcus aureus subsp. aureus USA300) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKVI
REVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAINMSEERTV
EVPVQLVGEAVGAKEGGVVEQPLFNLEVTATPDNIPEAIEVDITELNIND
SLTVADVKVTGDFKIEN

Ligand information

>4wf9 Chain Y (length=114) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc

.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><....<....<.<............>.>.....>
...>..>..>.>>.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4wf9 Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
Resolution	3.427 Å
Binding residue (original residue number in PDB)	R15 D17 R22 V30 Y32 N38 Q78 H88
Binding residue (residue number reindexed from 1)	R13 D15 R20 V28 Y30 N36 Q76 H86

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wf9, PDBe:4wf9, PDBj:4wf9
PDBsum	4wf9
PubMed	26464510
UniProt	Q2FJE0\|RL25_STAA3 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]